SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040822 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000040822
Domain Number - Region: 55-65
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000248
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040822   Gene: ENSMODG00000029261   Transcript: ENSMODT00000043930
Sequence length 681
Comment pep:novel chromosome:BROADO5:5:298522756:298524798:1 gene:ENSMODG00000029261 transcript:ENSMODT00000043930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKTSCRSRLRKIHLRKNEENTSASLIRGYTFFKSRALGSPVTHPPPSPSPPPPPPPPPP
PPPPPPPSPKVPEENIQYSIPNPLLCTTDAPSETLQVSYFSTPSTSSAVAQRPSLVEPFL
LDKSVQVSSYSDLSTGGELTEFPPSTSTSSASESTKGLSTSSSEDHIASRLTALTKAVQF
PSVSDVATSTDVSENPSMEEAIPFALTKAVQCPSVSDVATSTDVSENLSMEDATPLALTK
AVQCPSVSDIATSTDVIENPPMDDVVTPELTKAVRCVCISDVSISTDIIEDLNQSVKSSP
ISGPKEPIDVPAFSELTSIREPIQALMSPSRPTQILPILDPMPTNEFVTGELLPNLVPSP
SREFIQDLTISRTISGSKSVQVPSSAGIISSCKSIKFSSSSIGFSMTKAKQVPLYCCAST
SSESIEVPSFSVMLSSNQATQVPSFSDLGPPQENIHRPLPHKFSGLHKSTQVPAFSDESS
SIVGMEIAGSFSGPLSSRECIQHSSDIVAVSGSRLLSPPHSDPAIPDISTEELPYSQEPH
SSKELINASFSETNSPREGTQVPSTCDAFDITNSEQLSLISDLNATVVGREKIMSFSGSL
LSRKPLEYSSNFVAISVTKQTKLPSSSDPRSLNVNTEEFSSILFPFCPVVSRQFSNSPLN
SFSRENPQIPSXXXXXXXXXX
Download sequence
Identical sequences K7E4X0
ENSMODP00000040822 ENSMODP00000040822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]