SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040931 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040931
Domain Number 1 Region: 165-302
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-41
Family C-type lectin domain 0.0000887
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040931
Domain Number - Region: 67-146
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0209
Family Formin homology 2 domain (FH2 domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040931   Gene: ENSMODG00000027477   Transcript: ENSMODT00000044040
Sequence length 304
Comment pep:known_by_projection chromosome:BROADO5:3:462904250:462911066:-1 gene:ENSMODG00000027477 transcript:ENSMODT00000044040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSNYQKWEEDKDNLVLDKSQQVESSQSTGSWRKLLPRDPPSKSAFLMLSITLLLLILL
IVTLVKGSKTSQELNQLKQEMRTNASSQTKDVKQLREDIVAAKRNGSTLWASLGSSEKKL
SETHARLLNLESKHDELSTQMTQALADAGKDRQDIRSEMFRAVAAVKTGNSSCSPCPDSW
LAFEGSCYFFSTTKAHWDKSQQNCAKEQAHLVIVNNLEEQTFLTQNTKGLGYWIGLTATR
SRGRVNGYIWIDGTKLTFSYWNEGEPNDSRKNENCIMILYSGRWNDAPCANLNDYWICEK
RQQC
Download sequence
Identical sequences K7E579
ENSMODP00000038919 ENSMODP00000040931 XP_007489596.1.35504 ENSMODP00000038919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]