SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041084 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041084
Domain Number 1 Region: 3-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000398
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041084   Gene: ENSMODG00000027443   Transcript: ENSMODT00000044194
Sequence length 90
Comment pep:novel chromosome:BROADO5:Un:53325324:53365493:-1 gene:ENSMODG00000027443 transcript:ENSMODT00000044194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIAGTHRSKSHVLQY
HPTVKINTRDQMYRELLFPSPIKSFCVICI
Download sequence
Identical sequences K7E5N2
ENSMODP00000041084 XP_007506705.1.35504 ENSMODP00000041084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]