SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041235 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000041235
Domain Number - Region: 51-137
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00785
Family Formin homology 2 domain (FH2 domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041235   Gene: ENSMODG00000029027   Transcript: ENSMODT00000044344
Sequence length 173
Comment pep:known_by_projection chromosome:BROADO5:2:72195544:72210849:1 gene:ENSMODG00000029027 transcript:ENSMODT00000044344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSTMSVKKAEMKRPYMADKSNTSRKRSPRIKNQKSLRKGTEIEATQSGEDKELKQEM
SLVKKGGAQDIKNELKEVREELRGKMEEIQQIKDIMDKDFDKLQELVDIMKDMQKDMDER
MEVLIKLQTNKKQKKNQHTKTKDSPDRFSGRTYYEKCLSCSQKNYKSIRDPRN
Download sequence
Identical sequences K7E633
ENSMODP00000041235 ENSMODP00000041235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]