SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000623 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000623
Domain Number 1 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000119
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 804-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000105
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1003-1053
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000195
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000623
Domain Number - Region: 420-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0068
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000623   Gene: ENSMODG00000000520   Transcript: ENSMODT00000000638
Sequence length 1072
Comment pep:known_by_projection chromosome:BROADO5:5:133101134:133364842:1 gene:ENSMODG00000000520 transcript:ENSMODT00000000638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQEQPKRLPSHGSRQEDAEGELSEEEHWFGNSSETPSEASYGEVQENYKLSLEDRI
QEQSTSPDTSLGSATPSSNTLELIALENEALRDPLQCQDHLSPGVSSLCDDDPPGSNKPL
SSNLRRLLEAGSLKLDATVTANGRVESPVNLGSNLSFSPPSHHAQQLSVLARKLAEKQEQ
NDQYIAGNRFIWNQGKWLPNSTTTCGLSPDSAILKLKAAANAVLQDKSLTRTEETMRFES
FPSPFSSQSASSTLAALSKKVSERSLTPGQEHSPPASSFLSLASMTSSAALLKEVAARAA
GSLLAEKSSLVPEDPSPPQPLEKKQEKGTPPQSLELLLLPVPKGRVSKPTNPAPEEEGGK
PFQCPICGLVIKRKSYWKRHMVIHTGLKSHQCPLCPFRCARKDNLKSHMKVHQHQDRGET
FQCQLCPFTSSRHFSLKLHMRCHQHFLRTEAKVKEEIPEMDVKGSPQLSESACLGQQREG
VGTELVGTPVMSRTPERTSQSSAGIPPLLVKEEPKEDNGLSPSFTLNVAERPVNNTKLKD
TSDYVANTASALFSQDISVKMASDFLMKLSAANQKEPMTLTFKVKEEPKDEEAINSTLSQ
SSYIFRPGSEGSAPSLPEDTMKPQEGQMNTLRRDMSVKAASELLMKLSAESYKETQTVKI
KEEPMEVDIHDSPVSISPSRNVGYSTLLGREKTEPLQKMPEGRMGPERSLFSQDISVKMA
SELLFQLSEKVSKEHNHTKENTIRTTTSPFFSEDSFRQSPFTSNSKDLLPSESVLHSGTS
VPETEKIGLEAGNGLPSWKFNDQLFPCDVCGKVFGRQQTLSRHLSLHTEERKFKCHLCPY
AAKCRANLNQHLTVHAVKLVSTDTEDIVSAVTSEGSDGKKHPYYYSCHVCGFETELNVQF
VSHMSLHVDKEQWMFSICCTSCDFVTMEEADIKAHISTKHTGEERKTPSESTSPSSSSLS
ALSDSANSKDDTDVTQKTKGGNNLLVISVVPGSQPLLNTEEKSEKGFECVFCNFVCKTKN
MFERHLQIHLITRMFECDVCHKFMKTPEQLLEHKKCHTVPTGGLNLCSRMTK
Download sequence
Identical sequences F6Y5F1
XP_007496324.1.35504 ENSMODP00000000623 ENSMODP00000000623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]