SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000961 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000961
Domain Number 1 Region: 34-501
Classification Level Classification E-value
Superfamily Cytochrome P450 1.31e-126
Family Cytochrome P450 0.00000000000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000961   Gene: ENSMODG00000000796   Transcript: ENSMODT00000000980
Sequence length 508
Comment pep:novel chromosome:BROADO5:6:80734338:80768989:-1 gene:ENSMODG00000000796 transcript:ENSMODT00000000980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIIPSLSAGTWTLIVLFLTLLYLYGTRTHKLFKNLGIPGPTPLPFFGTVLAYRKGFADF
DYGCFKKYGKTWGFFDGRQAVLAIMDPETIKTVLVKECYSVFTNRRMFGPSGFLEKAISI
AKDEQWKRIRTVLSPTFTSGKLKEMFPIINQYGDVLVKNMKKEAEKSKPVTMKEIFGAYS
MDVITSTSFGIHVDSLNNQNDPFVREIKKLIRFSFLDPLILSTTIFPFLIPLFNKLDITV
FPKEATDFLAKSIIKIKEERTKSTEKASRPLQYFLQLMMDSQTSKNSESHSQKDLSDEEI
LAQSIIFIFAGYETTSSVLSFLFYHLATNPKIQEKLQKEIDAFLPNKEAVTYDALVQMEY
LDMVINENLRLYPIAGRIERVAKKTVELNGLTIPKGTVVMAPPYVLHRDPEYWPEPEEFR
PERFSKENKESINPYVYLPFGAGPRNCIGMRFALMSMKVAVSRLLQEFSFRPCKETQIPL
KLSNQPLLTPTVPIVLQAELRNKKGNQH
Download sequence
Identical sequences F6S9U5
ENSMODP00000000961 ENSMODP00000000961 13616.ENSMODP00000000961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]