SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001350 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001350
Domain Number 1 Region: 122-155
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000628
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001350
Domain Number - Region: 100-207
Classification Level Classification E-value
Superfamily HydA/Nqo6-like 0.000392
Family Nickel-iron hydrogenase, small subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001350   Gene: ENSMODG00000001134   Transcript: ENSMODT00000001378
Sequence length 240
Comment pep:known_by_projection chromosome:BROADO5:1:57754622:57887422:-1 gene:ENSMODG00000001134 transcript:ENSMODT00000001378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLSAIDTSAASVYQPAQLLNWVYLSLQDTHQASAFDAFRPEPAGASHPELGYGKGSPE
QLGSPLNSSYLNSFLQLQRGEALSSSLYKSASPYGSLNNIVDGLSSLTEHFSDLSLSSEA
RKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGLTPYQGKKRCFGEYKCPKCKRKWMS
GNSWANMGQECIKCHINVYPHKQRPLEKPDGLDVSDQSKEHPQHLCEKCKVLGYYCRRVQ
Download sequence
Identical sequences F7D4T0
ENSMODP00000001350 13616.ENSMODP00000001350 ENSMODP00000001350 XP_001364902.1.35504 XP_020861728.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]