SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002308 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002308
Domain Number 1 Region: 102-187
Classification Level Classification E-value
Superfamily E set domains 0.0000000000609
Family Filamin repeat (rod domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002308   Gene: ENSMODG00000001891   Transcript: ENSMODT00000002356
Sequence length 530
Comment pep:known_by_projection chromosome:BROADO5:4:62154981:62210233:-1 gene:ENSMODG00000001891 transcript:ENSMODT00000002356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTNFCKPWFFCCLLAALTIVLLVLNVSQLEHLDHESVSATFIDTSGQDIPLEATGVSRK
PYCGYEHQILSKRERLEEASLLEALQSHESYTDLVPFVKSTDPSSSYFVILNSGAFFKVG
SQLEVLVQVQDFQGRPKKYGGDYLQARIHSPKLQAGAVGRVVDYQNGCYKVFFTLVWPGK
VTVSIVLVHPSEAIRGLPHLQEERPDRVYFKSLFRSGRISEITICNVCLPGNLPVCNFTD
LYTGEPWFCFQPKKLPCSSRINHYKGGYLKGLLTTAESAFFQSDVNIKMPIHSSGPDWVT
VIPHGAKETNDPEPSQSMENFPSGYYYKNQWMSRKFKMHQFNEPENITECLQGKMIYLFG
DSTIRQWFDYLITFVPDLVEFNLGSPKNVGPYLAVDLKHNILLRYRCHGPPIRFTTVLSN
ELHYVANELNRIVGGRSTVVAIAIWSHFSTFPLEVYIRRLRNIRRAVVRLLDRSPKTVVV
IRTANVQELGPEVSLFNSDWFSVQLDTILRKMFSGVGYGMYDLRTEAEES
Download sequence
Identical sequences F6WGG1
ENSMODP00000002308 XP_007493600.1.35504 ENSMODP00000002308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]