SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002852 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002852
Domain Number 1 Region: 134-177
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000392
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002852
Domain Number - Region: 45-115
Classification Level Classification E-value
Superfamily Tropomyosin 0.0105
Family Tropomyosin 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002852   Gene: ENSMODG00000002339   Transcript: ENSMODT00000002908
Sequence length 382
Comment pep:known_by_projection chromosome:BROADO5:8:213931294:213946509:-1 gene:ENSMODG00000002339 transcript:ENSMODT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPSPLPARPSARAAASPGLGTRPRAMAEAAPAPISPWTMAATIQAMERKIESQAARLLT
LEGRTGTAEKKLCDYEKMAVEFGNQLESKWAVLGTLLQEYRLLERRLENMENLLKNRNFW
ILRLPPSSKGEVPKEWGKLDEWQKDLYKHVMRGNYETLVSLDYAISKPEVLSRIEQGKEP
CGWRRAGPKNPDIHTDPNPGSPVPAPDLLLQIKQEGELGLQGQQASGVEAWVASQPDTGE
ESWALSQLNSGAAELSTDVSPGMHPSFSTAIPTNSWQAELPPHHPSSACSDGTLKLSTVA
SSEGDVKIAIKTEVPEEKVVSAADPVHPAHLEAHGALFEPGQVSRLFPNTVPNAAWENQG
NPFPSQEALLGLREPSRPDRDL
Download sequence
Identical sequences F7GLT5
ENSMODP00000002852 ENSMODP00000002852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]