SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000003377 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000003377
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-26
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 364-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 406-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000003377   Gene: ENSMODG00000023148   Transcript: ENSMODT00000003448
Sequence length 452
Comment pep:novel chromosome:BROADO5:2:521865436:521879675:1 gene:ENSMODG00000023148 transcript:ENSMODT00000003448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSIQETLTFKDVAVEFTWEEWRHLDPAQRALHRNVMLENYENLISIGKQNQPLEALREE
KGQEERVMDRLILKAVEVKEDVLKKPLAIDKPQKKRGRGQQAAATGGSSQIGEVWQCREW
RSKEGMSEQGSGAFVDDGKVKALTLEIFPIMNIPKSTGENLDVHQRIHTGEKPYECNLCG
KAFIQRGKLTVHQRIHTGEKPYACNLCGKAFMWRHRLTVHQRIHTGEKPYACNLCGKAFR
SRMSMVKHQRVHTGEKPYECGQCGKAFRSRRSIIEHQRVHTGEKPYECGQCGKAFRSRRS
IIEHQSIHTGEKPYECDQCGKAFTQKSGLFIHQRIHTGEKPYGCNQCGKAFTHKSVLTKH
QRIHTGEKPFECNLCGKAFIQRGELTVHQRIHTGEKPFECNLCGKAFIQKGKLTVHQRIH
TGEKPYECNQCGKAFIQRASLTVHQKIHTGEK
Download sequence
Identical sequences F6YGM5
ENSMODP00000003377 ENSMODP00000003377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]