SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005618 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005618
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily RING/U-box 0.0000489
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005618
Domain Number - Region: 87-140
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0628
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005618   Gene: ENSMODG00000004558   Transcript: ENSMODT00000005737
Sequence length 301
Comment pep:known_by_projection chromosome:BROADO5:1:172588303:172671599:1 gene:ENSMODG00000004558 transcript:ENSMODT00000005737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWFHCNQCFRKDGTHFFVTSCGHIFCKKCVTKEKCAVCGATCKHLALSDNLKPQEKMFF
KSPVETALKYFSHISQVWSFQKKQTDLLITFYKHRLSKSEAAMQEAQRTVASQDKELVIL
RKENGELKKFLAILKESPSRCQGSRSTTPRPVGITSPSQSVTPRPTSQNSNQVVSQPSSL
ESIPYRVSGFGSFGQQGNRGLQGRNTSRESYTDTPSPASTNSLSYGALSASSGPGIFSVS
PYLGGVGGTTGLIPSRSSQSDSRSAPETPVALQLPVLQLQVTPQTPQLHQTRLSNNRGRC
D
Download sequence
Identical sequences F6R5C5
XP_007479878.1.35504 ENSMODP00000005618 ENSMODP00000005618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]