SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006052 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006052
Domain Number 1 Region: 10-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000133
Family HkH motif-containing C2H2 finger 0.00033
Further Details:      
 
Domain Number 2 Region: 139-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000714
Family HkH motif-containing C2H2 finger 0.011
Further Details:      
 
Domain Number 3 Region: 92-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000524
Family HkH motif-containing C2H2 finger 0.0018
Further Details:      
 
Domain Number 4 Region: 212-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000223
Family C2HC finger 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006052   Gene: ENSMODG00000004918   Transcript: ENSMODT00000006180
Sequence length 273
Comment pep:known_by_projection chromosome:BROADO5:1:382524190:382549911:1 gene:ENSMODG00000004918 transcript:ENSMODT00000006180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMFGSNGDTAGPVGKEAVDRMIQENNHLFTDVQCKVCNAVLISESQKLAHYQSKKHAN
KVRRYTSIHKEEEFNDGKKLKLDSKQESSHGDDRDRCCAICNMTFSSPIVAQSHYLGKTH
AKNMKLKQSNSQAEVPSKLPMNAPGFSEDSSDTSDPDKFCSLCHASFNNPSMAKQHYVGK
KHKKQETKVKLMAHYGKSKDSPVTASEAGWGYPCNTCKIILNSIEQYQAHISGFKHRNHI
PGAVPILGRFPKQQYVREETVSSGDYSYFSQDS
Download sequence
Identical sequences F7BH19
XP_007474184.1.35504 ENSMODP00000006052 ENSMODP00000006052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]