SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006791 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006791
Domain Number 1 Region: 1127-1345
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.06e-85
Family Fibrinogen C-terminal domain-like 0.00000107
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-25
Family Fibronectin type III 0.0000108
Further Details:      
 
Domain Number 3 Region: 955-1120
Classification Level Classification E-value
Superfamily Fibronectin type III 2.74e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 777-938
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-21
Family Fibronectin type III 0.0009
Further Details:      
 
Domain Number 5 Region: 416-590
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-18
Family Fibronectin type III 0.00000758
Further Details:      
 
Domain Number 6 Region: 326-413
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000206
Family Fibronectin type III 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006791
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 207-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00569
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006791   Gene: ENSMODG00000005481   Transcript: ENSMODT00000006929
Sequence length 1358
Comment pep:known_by_projection chromosome:BROADO5:2:67662819:67925590:-1 gene:ENSMODG00000005481 transcript:ENSMODT00000006929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIDGETVVLKNVLIGVNLILLGSVLKPSDCQLEVTTERVRRQVVEEEGGIVNYSASSKE
HPMVFNHVYNINVPLDSLCSSGLEASAEQEMSAEDERMTEYMDHTSDSESQVTFTHRINL
PKQACKCSSSAQVMQELLSRIEMLEREVSMLRDQCTSNCCQESAATGQLDYIPHCSGHGN
FSLESCGCICNEGWFGKNCSEPYCPMGCSSRGVCVEGQCVCDSDYSGDDCSELRCPTDCS
SQGLCVDGECVCEEAYTGEDCSELRCPGDCSGKGRCTNGTCFCQEGYVGEDCGQRRCLNA
CSGRGHCQDGFCFCEEGYQGPDCSAVAPPEDLRVVWISDKSIELEWDGPMAVSEYVISYQ
PTVLGGLQLQQRVPGDWSAITIKELEPGLTYNVSVFAVISNTFSLPAIAKVSTHLSTPQG
LKFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKDQARSFPTAASISTLIDGPTQILVRDVSDTVAFVEWTPPRAKVDFILLKYGL
VDGEGGRTTFRLQPPLSQYSVQALRPGSHYEVSVSAIRGTNESTATTTHFITEIDAPKNL
RVGSRSATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHELVAPKNPGPTTRATLTNLVPGT
EYGVGISAIMDSQQSVPATMNARTDLDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPASGMSSEITVPKDRTSYTLTDLEPGTEYIISVTAERGRQQSLESTVDAFTGFRPITHL
HFSHVTSSSVNITWSDPSPPADRLILNYNPRDKEEESLEVSLDATKRHAILIGLQPATEY
IVNLVAVHGMVTSEPIVGSITTGIDPPKEIIISNVTKDSVTVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVNEFTVTNLYPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLKWKSPVGEVENYVLVLTHFTVAGETILVDGINEEYQLVDLLPNTHYTIT
MYATNGPLTSSTINTNFTTLLDPPTNLTASEVTRQSALISWQPPIADIENYILTYKSTDG
SRKELIVDAEDTWIRLEGLSENSEYIVLLQSAQDAIHSVITSASFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYTISINGDRSQKVQVYCDMTTDGGGWIVFQRRQNGLTDFFRKWAEYRVG
FGNLEDEFWLGLDNMHKITSQGRYELRIDMRDGQEAAYAYYDKFSIGDSRSLYKLRIGDY
NGTAGDSLTYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRPTVGRKRRSLQL
Download sequence
Identical sequences F7BXQ0
ENSMODP00000006791 ENSMODP00000006791 XP_001373512.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]