SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006944 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006944
Domain Number 1 Region: 405-530
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000738
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 340-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000142
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 3 Region: 308-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000566
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 381-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000002
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006944
Domain Number - Region: 269-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0407
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006944   Gene: ENSMODG00000005607   Transcript: ENSMODT00000007084
Sequence length 729
Comment pep:known_by_projection chromosome:BROADO5:2:456362727:456372331:-1 gene:ENSMODG00000005607 transcript:ENSMODT00000007084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQSMLTFAVFSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGSGGGSSSAASGS
GLLQCDCKTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGANSFSVPDSASNADPAFSNPI
RFPFGFTWPGTFSLIIEALHTDSPDDLATENPDRLISRLATQRHLTVGEEWSQDLHTSSR
TDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTEPICLP
GCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQD
LNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGANCEIEINECDANPCKNGGSCTDLEN
SYSCTCPPGFYGKNCELSAMTCADGPCFNGGRCTDNPDGGYTCHCPVGYSGFNCEKKIDY
CSSSPCSNGAQCVDLGNSYLCQCQAGFTGRHCDNNMDDCASFPCVNGGTCQDGVNDYSCT
CPPGYTGKNCSAPVSKCEHGPCHNGATCHERNHRYVCECARGYGGLNCQFLLPETPQVVP
GKFMEGQNGQFPWIAVCAGIILVLMLLLGCAAVVVCVRLKLQKRQPPADTCRGETETMNN
LANCQREKDISVSIIGAAQIKNTNKKADFHGENNSDKNGFKTRYPAVDYNLVHDLKNEDP
SREEHSKCEAKYETHDPGVEDKSTTPLKGGETSERKRPESVYSTSKDTKYQSVYVISEEK
DECIIATEV
Download sequence
Identical sequences F7CZU6
13616.ENSMODP00000006944 ENSMODP00000006944 ENSMODP00000006944 XP_007485001.1.35504 XP_007485002.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]