SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008075 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008075
Domain Number 1 Region: 325-623
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.38e-90
Family beta-glycanases 0.000000000267
Further Details:      
 
Domain Number 2 Region: 21-220
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-59
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000000111
Further Details:      
 
Domain Number 3 Region: 223-324
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 1.06e-28
Family beta-Galactosidase/glucuronidase domain 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008075   Gene: ENSMODG00000006507   Transcript: ENSMODT00000008239
Sequence length 650
Comment pep:known_by_projection chromosome:BROADO5:2:508247316:508266559:1 gene:ENSMODG00000006507 transcript:ENSMODT00000008239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACWLWVAWVAALGSRALVLAGGMLYPQETPSRERKDLSGLWDFRADFSEDRNQGFRERW
YQSPLRETGPVLDMPVPASFNDVGQDAKLQNFIGWVWYERQVMVPQSWARDPGTRVMLRI
GSAHYYAIVWVNGVHVAEHEGGHLPFEADISRLLRSDAGEPCRVTVAINNTLTPHTLPPG
QIEYKTDRLRYPKNYFIQLTHFDFFNYAGLHRPVFLYTTPASYIEDISVTPEVAQSTGLV
NYEIVVHGSENFELDVLLWDKEGRAVAKGTGARGQLQVPDAQLWWPYLMHEQPAYLYSLE
VTLVVQTGAGTVSDVYTLPVGIRTVTVTHNQFLINGKPFYFHGVNKHEDSDIRGKGFDWA
LLVKDFNLLRWLGANSFRTSHYPYAEEVMQLCDRYGIVVIDEAPGVGIVQWESFGNISLN
HHLEVMEELVQRDKNHPSVVMWSVANEPASWLPPAAYYFKTLIAHTKALDPTRPVTFVSN
SRPEADNGAPYVDVICINSYYSWYHDSGHLEVIQLQVSTTFENWNQLYQKPIIQSEYGAD
AIPGFHQDPPKMFSEEYQKVVLQQYHLALDQKRKDYVIGELIWNFADFMTDQSVMRVMGN
KKGIFTRQRQPKGSAFLLRERYWRIANETRHPHLAMITQCVENQLFYSLN
Download sequence
Identical sequences F7EJZ4
ENSMODP00000008075 XP_001363090.1.35504 ENSMODP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]