SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000008930 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000008930
Domain Number 1 Region: 35-86
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 4-45
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000156
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 102-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000537
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 130-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000772
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000008930   Gene: ENSMODG00000007205   Transcript: ENSMODT00000009105
Sequence length 166
Comment pep:novel chromosome:BROADO5:1:81573166:81573706:-1 gene:ENSMODG00000007205 transcript:ENSMODT00000009105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GESYTGEKPYKCDECGKGFIWRAYLSAHQRAHTIENLYTCDQCGKELKKLHTGKKSYECD
GCGKGFIRRGYLIVHQKIHTGEKPYKLKTSFKEHTPMFNGDHIVEKPYKCDECGKGFIQK
ACLSVHQIIHTGEKPYTCDENVEEDSESNFYRYQRLHTGEKPYQCD
Download sequence
Identical sequences F6WTJ8
ENSMODP00000008930 13616.ENSMODP00000008930 ENSMODP00000008930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]