SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000009690 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000009690
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000244
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 129-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000299
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 363-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000477
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000009690   Gene: ENSMODG00000007802   Transcript: ENSMODT00000009881
Sequence length 419
Comment pep:known_by_projection chromosome:BROADO5:1:84710809:84740870:1 gene:ENSMODG00000007802 transcript:ENSMODT00000009881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVE
VSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASA
YERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWG
VLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDTYESMGKTTQTSGLP
RDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCSDEKPFMIQQPTTPAVISAV
STSMPQSSSPTSPEPRPSHSQRNYSPVAGPSSERSAHTSTPSISNSQPSTPTPVLPVQDP
QLLHHCQHCDMYFADNILYTIHMGCHGFENPFQCNICGCKCKNKYDFACHFARGQHNQH
Download sequence
Identical sequences F6ZIR3
ENSMODP00000009690 XP_001376294.2.35504 XP_016283171.1.35504 ENSMODP00000009690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]