SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010182 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010182
Domain Number 1 Region: 83-123
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000157
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010182   Gene: ENSMODG00000008189   Transcript: ENSMODT00000010378
Sequence length 194
Comment pep:novel chromosome:BROADO5:3:502775176:502781227:1 gene:ENSMODG00000008189 transcript:ENSMODT00000010378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRECPGMVTEVFVYICDLSDHSNLKPWTLTKANPSLLTIGRDSSTSIPSYEEAIEYLDL
RPFPLRYLERGGDRTAGGTEPEVVKVLDVAVDFTGEEWRLLSPFQKELYKEVMLENAQNL
LYVVLTDELLLILLLGYSSSPGLSAPPEYMLLFGAEGSPMDARGKRAEELLPSFRLTQSG
NAETARKAQEPELS
Download sequence
Identical sequences F7DJU1
ENSMODP00000010182 13616.ENSMODP00000010182 ENSMODP00000010182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]