SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010194 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010194
Domain Number 1 Region: 262-345
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010194
Domain Number - Region: 352-402
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00204
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010194   Gene: ENSMODG00000008198   Transcript: ENSMODT00000010390
Sequence length 591
Comment pep:known_by_projection chromosome:BROADO5:1:353948370:354399421:-1 gene:ENSMODG00000008198 transcript:ENSMODT00000010390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDP
VIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKH
GRRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLV
WSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQ
LPALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGNAGMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences F7DJ52 F7FNQ0
ENSOANP00000019522 XP_001507183.1.37387 XP_012407532.1.9362 XP_020848023.1.61212 ENSMODP00000010194 13616.ENSMODP00000010194 ENSMODP00000010194 ENSOANP00000019523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]