SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010203 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010203
Domain Number 1 Region: 275-358
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000010203
Domain Number - Region: 365-412
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0837
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010203   Gene: ENSMODG00000016702   Transcript: ENSMODT00000010400
Sequence length 597
Comment pep:known_by_projection chromosome:BROADO5:1:736401982:736668360:1 gene:ENSMODG00000016702 transcript:ENSMODT00000010400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQDTLGRGPALKEKALGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
TEQDLFVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCRNRGNKAINKMLCGKDGPAE
QPSSLCNLFLFLCRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDN
MFVHNNSKHGRRARRLDPSEEGTSLIYGSVSIATPCIKAISPSEGWTTGGAMVIIIGDNF
FDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTAL
NEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADI
AEALYSVPRNPSQIPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISP
RGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVG
SSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM
Download sequence
Identical sequences F7AL94
ENSMODP00000010203 ENSMODP00000010203 13616.ENSMODP00000010203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]