SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000010468 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000010468
Domain Number 1 Region: 36-510
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-115
Family Cytochrome P450 0.000000000531
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000010468   Gene: ENSMODG00000008416   Transcript: ENSMODT00000010673
Sequence length 510
Comment pep:known_by_projection chromosome:BROADO5:4:385281365:385291431:1 gene:ENSMODG00000008416 transcript:ENSMODT00000010673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALATGVASPLLVLVLVLVLLLALLVLRQGRPRSSRLPPGPPPLPLLGNVGQLRLSPLFN
PSDCFSLQLSAKYGPVFTVYLGSRPVVVLSGYRAVKEALVDQAEAFSGRGKIAGLEKTFH
EHGLFFANGEQWRSLRKFTTLSLRALGMGKKEGEEHIQEEARCLLEALRSTQGSPLDPSL
LLSQAVSNITCLLLFGKRFDYEDKKFQAMVLATAGILTEISSPWGQVCEMFMGPVCYLSD
ILKYLSAPHGRLTRHLSTLAAFVSDQIQQHQETLDPEAPVRDFIDDFLLKMRQEEKAQGV
GPDHTDFLLTTVNLLFAGTVTVSATLRFAFLLLLKYPEFQDRIHEELNQELGRERAPSLG
DRGRLPYTDAFLHEVQRFLALIPMGVPRTVTKPTIFQGYELPQGIEVFPLLGSVLHDPEF
FERPKEFYPRHFLNADGRFIKNEAFLPFSSGKRICLGEGLARTELFLFFTTILQNFSLES
PSPLGALSLHPAISGFANIPPTFQLRFRPR
Download sequence
Identical sequences F7B887
ENSMODP00000010468 ENSMODP00000010468 XP_007492004.1.35504 13616.ENSMODP00000010468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]