SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011788 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011788
Domain Number 1 Region: 48-507
Classification Level Classification E-value
Superfamily Cytochrome P450 5.37e-123
Family Cytochrome P450 0.00000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011788   Gene: ENSMODG00000009434   Transcript: ENSMODT00000012011
Sequence length 516
Comment pep:novel chromosome:BROADO5:1:23140512:23149461:-1 gene:ENSMODG00000009434 transcript:ENSMODT00000012011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSILSLLGFSKSFTVTELLVVSAVFCLVFWIIDSYHQRVPKGFKSPPGPWAWPLIGNV
LTLGKNPHLVLTQMREKYGDVMQIQIGSTPVLVLSGLETIRHALVKQGDDFKGRPDLYSF
SLILDGESLSFGPDSGEVWAARRKLTQNALKAFSISSSPSSSFCYLEEHVIKEAEYLIQK
FQEQKGHFDPVRYIVVSVANVICAICFGQRYDHDDQELLNIVRLSNKFGEVAASGNPVDF
IPILRYLPNSKITAFRDLNEKIVAFTQKLVKEHYRKFEKGCIRDITDSLIEHCQEKKLDE
NANIMLSEKKVVNVVIDLFGAGFDTVTTAISWGLMYLVAKPEVQKKIHEELDTVIGRERL
PQLSDKTQLPYMEAFILETFRHSSFLPFTIPHSTTRDITLNGFYIPKGRCVFVNQWQINH
DPKIWGDPSVFRPERFLSVDGTINKALSEKVIMFGLGKRKCIGETIARWEVFLFLSILLH
RMEFSVPSGVKVDLTPVYGLTMKHIPCEHFQTKLRS
Download sequence
Identical sequences F7BKP6
XP_001379519.1.35504 ENSMODP00000011788 ENSMODP00000011788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]