SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011989 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011989
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.75e-46
Family DJ-1/PfpI 0.0000000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011989   Gene: ENSMODG00000009595   Transcript: ENSMODT00000012213
Sequence length 189
Comment pep:known_by_projection chromosome:BROADO5:4:435057258:435079521:-1 gene:ENSMODG00000009595 transcript:ENSMODT00000012213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKKALVILAKGAEEMETVIPVDLMRRAGIKVVLAGLSGKDPVQCSRDVFICPDESLED
AKKQGPYDVIVLPGGNLGAQNLCESPVVKTLLKEQEKNKGLIAAVCAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYTYTESRVEKDGNILTSRGPGTSFEFGLAIIAELMGKSVVDQ
VKGPLVLKD
Download sequence
Identical sequences F7A9B9
13616.ENSMODP00000011989 XP_007493105.1.35504 XP_007493106.1.35504 XP_007493107.1.35504 ENSMODP00000011989 ENSMODP00000011989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]