SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012043 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012043
Domain Number 1 Region: 56-504
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.39e-134
Family Family 1 of glycosyl hydrolase 0.000000107
Further Details:      
 
Domain Number 2 Region: 514-950
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.24e-98
Family Family 1 of glycosyl hydrolase 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012043   Gene: ENSMODG00000009636   Transcript: ENSMODT00000012267
Sequence length 1008
Comment pep:known_by_projection chromosome:BROADO5:4:304898244:304958895:1 gene:ENSMODG00000009636 transcript:ENSMODT00000012267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSFLPPSLPPSLPPSLSLLLCLLCLLCRCCLHAEPGDGVQTWARFSRAPSPEAAGFLYD
TFPDGFLWAVGSAAYQTEGGWRQHGKGASIWDTFTHRPAAPPRDGQPQLPVPSNSWPHPA
TGDVAGDSYNHIFRDTEGLRQLGVTHYRFSISWARVLPNGGGVGAGPPNLEGLRYYRRLL
ERLRELRVEPVVTLYHWDLPQRLQDIYGGWANRTVVDLFRDYAELCFRQFGGQVKYWITI
DNPYVVAWHGYSTGRLAPGVRGNKRLGYQVAHNLLLAHAQVWHLYNTSFRSTQGGQVSIA
LSSHWISPRKMTEHDLKECQKSLDFVLGWFAKPIFIDGDYPQSMKENLSSLLPNFTESEK
NFIKGTADFFALSFGPTLSFQLLDPHMKFRQLESPSLRQLLSIDLEYNHPQIFIVENGWF
VSGTTRRDDAKYMYYLKKFIMETLKAIKYDGVEVIGYTVWSLMDGFEWHRGYSIRRGLFY
IDFLSHDKKLLPKSSALFYQKLIERNGFPSLPENLPIEGTFPCGFAWGVVDNYIQVDTTP
SQFNDPNVYVWDIHQSKKLIRVDGVVTSKRKPHCVDFAAIRLQISLLREIHITHFYFSLK
WSQILPLGNQSQVNETILHYYRCFVSELVRVNITPIVALWQPTTEHQGLPFLLAKHGGWE
NPLIINSFEEYARLCFKELGQYVKFWITMNEPHIQNLTYNAGHNLLKAHAQVWHLYDQNF
RRSQKGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGTGDYPHVMREWL
NQRNNFLLPYFTKSEKKLIQGSFDFLALSHYTTILVDWEKEDPVKYNDYLEVQEMTDSTW
LNSPSRVAVVPWGLRKMLNWFKSKYGDIPVYIIANGIDDDPLRTQDKLRTYYIQNYVNEA
LKAHTLDGVRLCGYFVYSFNDRTAPKFGLYHYAANQFEPKPSMNHYRKIIDNNGFPGPET
QRRFCPEEFILCNECSFFQTRKSLLAFIAFLLLAFIATLSLIFYYSRR
Download sequence
Identical sequences F6QTV6
ENSMODP00000012043 ENSMODP00000012043 13616.ENSMODP00000012043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]