SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015236 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015236
Domain Number 1 Region: 28-345
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.74e-111
Family Bee venom hyaluronidase 0.0000105
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015236
Domain Number - Region: 391-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015236   Gene: ENSMODG00000012164   Transcript: ENSMODT00000015520
Sequence length 418
Comment pep:known_by_projection chromosome:BROADO5:6:204348106:204350411:-1 gene:ENSMODG00000012164 transcript:ENSMODT00000015520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGGCYLVAWATLCLVGGWATSWHLGRPFTAVWNVPTARCQTHFGQPLPLDPFDIVHNWA
QRFRGQNITIFYKNQFGLYPYLGPRGIVHHGGIPQAVSLHRHLALVANQISGLMHKGFRG
LAVLDWEEWHPLWNRNWGLRQVYRKAAWAWAQQQWPDLPPKQQHLKARTTFEQAARALME
STLQLGQALRPRGLWGFYRFPLCRSPWQGRHNYTGKCRKTDKVYNDQLYWLWKASSALFP
SIYLPPDLPQVYRKSYTRHRLEEAFRVAQFGHPRPLPVLAYARLTHPGSGQFLSQNDLIQ
TIGVSVALGVEGVVLWGDLSFSSSEEQCKHLQSYLSTILGPYLSNVTQAAQACSQQLCHG
NGRCARWEPSNDEVFLHLEPRRAQGTLMEGTAKWAHFRCLCYPGWEGTTCKVPVAGTE
Download sequence
Identical sequences F7CYI5
ENSMODP00000015236 ENSMODP00000015236 XP_007499960.1.35504 XP_007499961.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]