SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016119 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016119
Domain Number 1 Region: 2-432
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.31e-125
Family L-arabinose binding protein-like 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016119
Domain Number - Region: 440-487
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00589
Family TNF receptor-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016119   Gene: ENSMODG00000012884   Transcript: ENSMODT00000016417
Sequence length 788
Comment pep:known chromosome:BROADO5:3:525862297:525883973:-1 gene:ENSMODG00000012884 transcript:ENSMODT00000016417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNYQQALTLAFAIEEINKDSNLLPNISLGFHLYNTYHSDERTLESSLRWLSGQDQPIPNY
SCRKQDKSVAVIGGATSALSLQMGALLNLYKFPQISYGPFDSILSDKVQFPSLYQMAPKD
SSLHQGVVQLMVYFEWNWIGLIVTDDMRGEDFLWEIRREMVKNGVCMSFTEKIPVSERRH
MESQETFMPRILSSSTVVIVIHGDTDSLMILRYSQVPFFPIQKVWIATSHWDITMRHLYV
EGFAFHGALTFSYLTSEIPGFKTFLKTVTPSKYPDDILLKGFWLSVFKCPDQPENQEQEI
CSPNASLETLPLCSFDMTMSGLSYTLYNAIYAVAWTLHEILMRKSEKRSMGDEQYLVLHS
WQLHSFLKNTQFNNSAGDQVFVDENRSSEAQYAIMNYLTFSNETEVLVKVGQFVPKAPHG
QELTICMDVIMWGWWDSKVPSGVCSDSCDPGFRKTPLEGQAACCFDCSPCPEGEISSLMN
AEHCRKCPEIEYPNKQRDRCLPKIVTFLNVKEPLGMTLTCMAISFSLLTALVLGIFVKFQ
DTPIVKANNRTLSYTLLISLIFCFLCSLLFIGRPTTATCLLQQTVFVVVFTVAVSSILAK
TIIVVVAFRGIRPGSRIRMFIHPRVSYYIVLICSGLQVIFCAFWLVTSPPFPEADTHSQY
GHIIIRCNEGSAFAFYSVLGYLGFLALGSFSVAFLARNLPDTFNEAKFITFSMLVFCSVW
VTFLPTYQSTKGKAMVAVEIFSILASSAGLLGCIFIPKCYVILLKPDRNTQEQIKNKQAS
KGKIFPGV
Download sequence
Identical sequences F6ZNX1
ENSMODP00000016119 ENSMODP00000016119 13616.ENSMODP00000016119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]