SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017342 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017342
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.59e-40
Family L-arabinose binding protein-like 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017342
Domain Number - Region: 197-244
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00306
Family TNF receptor-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017342   Gene: ENSMODG00000013863   Transcript: ENSMODT00000017661
Sequence length 544
Comment pep:novel chromosome:BROADO5:3:527275574:527287980:1 gene:ENSMODG00000013863 transcript:ENSMODT00000017661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFNGALTFSYLTSEIPGFKTFLKTITPSKYPDDILLRGFWLSAFMCPKQPEKSEQEICSA
NASLETLPLCYFDMAMSGLSYTIYNTVYAVAWALHEIFMRKSEKRLMEDEEYLVLPSWQL
HSFLKNIQFNNSAGDEVFVDESRSSEAQYAIFNYMFLPNETDILVKVGQFVPKAPLGQDF
TICENSIEWGWWGSKVPHGVCSESCHPGFRKTLLEGKAICCFDCSPCPDGEISSHMDAED
CMKCPEIEYPNQQKDHCLSKIVTFLNMKESLGMMLTLVSISFSFLTALVLGVFVKFQDSP
IVKANNRTLSYTLLISLIFCFLCSLLFIGQPTTATCCLQQTVFAVVFTVAVSSILSKTII
VLLAFRSISPGSRIRMFMHPRVSVYVVLIGSGLQVILCGIWLGTSPPFPEADTQSEYGHI
IIRCNEGSAFAFYCVLGYMGFLALGSFTVAFLARNLPDAFNEAKFITFSMLVFCSVWATF
LPTYQSSKGKAMVTVEIFSILASSAGLLGCIFIPKCYMILLKSDRNTQGQIKNKRDSRGK
TFAG
Download sequence
Identical sequences F6WPD8
ENSMODP00000017342 13616.ENSMODP00000017342 ENSMODP00000017342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]