SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017362 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017362
Domain Number 1 Region: 70-155
Classification Level Classification E-value
Superfamily E set domains 0.0000000000771
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017362
Domain Number - Region: 325-522
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.00247
Family Acetylhydrolase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017362   Gene: ENSMODG00000013878   Transcript: ENSMODT00000017682
Sequence length 523
Comment pep:known_by_projection chromosome:BROADO5:4:237047544:237055499:-1 gene:ENSMODG00000013878 transcript:ENSMODT00000017682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHIMSCFLLFQFWPTLDPPISVYPWDVSRKPLCPKSPINPSKTDMKINKVKNHLNRLIPK
RSFFNVNTTTSAAHSVATILNPKATYCIGDKLDILLVARDYSGQRKKYGGDFLRARISSP
DLKAGASGTVTDFNNGTYLISFILFWEGRVTLSLLLIHPSEGVSSLWRARNRGYDKVIFT
GQFANGSSWVFSECGLVLNTSAEMCPYLDPRDQEAFYCVKPPHVSCEALAQLKSKNKAIS
YLSDLEKSLFIRSNVGVEILKSFHPVSVSVCSKQTISLKEKCKPGMWSPVPTGYVWNNVW
NLVTCNLSHFHTETQMNICLKGKLIYILGDSTTRQWIEYFIKNIKTLKSIDLHGFGNLRR
QLVVDLERKIYIQWQKHGYPLVGSNSYSAKENEYIARVIDRIAGDKNTIIVFSLGQHFRF
FPIDLFIRRAINIHKAIERLFQRSPETRVILKGENTREMNDDPERLSDFHGYIQAHILKD
MFQDLNVSFIDAWDMTIAYGTNNVHPPQYVVRNQINMFLNYIC
Download sequence
Identical sequences F6W8I8
ENSMODP00000017362 13616.ENSMODP00000017362 ENSMODP00000017362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]