SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019922 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019922
Domain Number 1 Region: 123-329
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000144
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019922   Gene: ENSMODG00000015965   Transcript: ENSMODT00000020278
Sequence length 606
Comment pep:known_by_projection chromosome:BROADO5:1:504013054:504048372:-1 gene:ENSMODG00000015965 transcript:ENSMODT00000020278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVRSTGGDGEALCVAEEEPVGEEEEMPAFPCTQNGKAGPSCSRCQKNLSLHTSVRILYL
FLALLLVAVAVLASLVFKKVDSLSEDISITQSNYEKKIVSVQENLQELDQKALGNCSFCH
DTGQLGQEIHKLQQELEEIQKMLLVQEIQLDQTSQTHQQLFSTSNQITAVVDSCSFSIHQ
VNQTLGQFLAQVRGWQAAMAGLDFSLKGLTQDCYDVKAAVQQINFTVGQTSDWVHMIQRK
TEEETLTLQKMVSEWQNYTRLFSGLRATSAKTGELVKSIQTSLSSASQRINQNSEGIHDL
VLQVMGLQLQLDNVSSFLDDHEENMHDLQYHTRYAQNRTVERFETLEGRMTSHEIEINTI
FTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLSTTDLLRERFSLL
RARLDFDIQNLSMVMEEMKAVDVRHGAILQNVTILRGIPGPPGPRGLKGDMGVKGPYGSR
GPKGDNGTMGPPGPQGPQGQPGKAGPAGERGPIGFKGFPGLKGSKGSFGSSGLKGQPGPK
GDMGPQGPEGPPGSPGPPGPQGKPGIAGKTGAPGQVGPTGPKGDPGIQGPQGLPGPPGLP
GNQSPY
Download sequence
Identical sequences F7FDF8
ENSMODP00000019922 ENSMODP00000019922 13616.ENSMODP00000019922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]