SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022571 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022571
Domain Number 1 Region: 882-1010
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.5e-16
Family cAMP-binding domain 0.025
Further Details:      
 
Domain Number 2 Region: 633-747
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000573
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022571   Gene: ENSMODG00000018104   Transcript: ENSMODT00000022965
Sequence length 1178
Comment pep:known_by_projection chromosome:BROADO5:4:73475827:73574774:-1 gene:ENSMODG00000018104 transcript:ENSMODT00000022965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSFRNSSSTLSYNVNHSWAINFGGILFSHSKDLPKIVLGLCVVTILGALLKVKMKDSH
FPLPLILFFIGCSFEILSFASYQVKQYAEMLQWMDPVIFINLFTPIIIFSVSFDIDFYML
QKLFWQIIFLTVPGFFLNYALVDWYLFSVNKLLLKGITRMLFAIIIVCTDPMLTTTAIKN
LGLSKGLTHLIKGECVFMAALAENTFKITLQIANNHHKEISTKLGIIILSDILIKFVGSS
LFGFVMYKAFQLWLRNIFSDDITEGMLSFSLIYISFYVAEWSGMSGIITLTVLALLLNST
SFKPGAQLFLFKFWKSLKFFAYLMIFTLIGLMIPAHTYLYLSFSDIYYAVHFYFTLIVIR
ILVFLIMSPILSRLGYGFTWRWAFTIVWSEMRGLLNINMALMFSYTDNALGTEGEKSQIL
LHGVTICLITLMINSITLPRAVIQLGLRDITLTQRKSLYYTVQHFQGIIKASASALRFDR
DLANADWNLVDKKIMFTNPYKLKPEEERQNLKCPDCNKEIREASINTEIMELARIRLLSA
QIASYERQYIHEILSQSAVKVLVGAAGSFGDKKGEFMSFQTIRAYAEKKKFFNFVRKILL
NWVYNTRKEKGVPSKNPVLLFCHKIVFNDEFESSVYLIIILNMAPLLISWIPQLYVIYEK
EARTVNHMFLSFYIIESILKLAAMRKGYFQHNWNLFELLIIVLGIIEEILMVTDAFKNSI
YVFQALIVLKISNLLRVFRILKLITPVLLQVIDRRMTHQLSFRYAILKGYVQGEADIACL
IDKISSSKLVAEELRKRVSMNAERAMKELGYLEYDHPDIAITMKTKEEINSLLGMASEIL
KNLKSKGIINKAEVAEIHKIIMAKRKHVFDFEPVIKLPSLDEVLYHISWLNKSKFHINFI
KKKVKILTFDCGNNIFEEGDSPRGIFVIHSGMIKRHSSKPYLGLDQQLLETKEKEKTVYA
DYLLSGAIIGELNCLTEKPMTFTATCKTVVETYFINKRDIYDIFNNCCPSIEYKMWLKLA
LAIGAKKVKEILAYEDWTYNLQLQLCNVYVRDVLLGYKVDIYDETVSYVILVYGSVEDCQ
LQKTYFAPELIPKTCHQIKGTARITKILVIQTSIDLKKCRSNTARYVPVCKHIRAGSKHK
MDFWLDDRFGDDTTAGKAVNAQKNSENFTVSLESLGAF
Download sequence
Identical sequences F7FFD3
XP_007493725.1.35504 XP_007493726.1.35504 XP_007493727.1.35504 ENSMODP00000022571 ENSMODP00000022571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]