SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023373 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023373
Domain Number 1 Region: 10-227
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-60
Family Ankyrin repeat 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000023373
Domain Number - Region: 573-761
Classification Level Classification E-value
Superfamily Tropomyosin 0.000275
Family Tropomyosin 0.0068
Further Details:      
 
Domain Number - Region: 769-877
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0162
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Domain Number - Region: 846-923
Classification Level Classification E-value
Superfamily t-snare proteins 0.0196
Family t-snare proteins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023373   Gene: ENSMODG00000018748   Transcript: ENSMODT00000023789
Sequence length 937
Comment pep:known_by_projection chromosome:BROADO5:2:494306094:494321426:-1 gene:ENSMODG00000018748 transcript:ENSMODT00000023789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEKWNRRDQKLLEAVQRGDVNRVSALTRKKTARPTKLDSHGQSPFHLAASKGLTECLSIL
LTNGAEINSKNEDGDTALHLATISCQPQCVKVLLQHGANEDAVDGENRSPLHWAASSGCA
SSVLLLCDHEAFLDVLDNDGRTPLMIASLGGHAAICAQLLQRGARVNVTDKEDKSALILA
CEKGSAEVAELLLSHGADVGAVDCMGHDALYYALRTQDKELWRLLRQALNRRQRGGQGLA
QHPDLSSQVKSKAFPFEPHIPDNLTPGSPPNCPIRAEPEEEDDKEEGGEELCSPQEWRRK
YEAERKKVSQLEQELVKKAEECKSQATACRGLESSVREQVQELGLLLAKESRDPGGQGVS
PRPGGDGMEHSCVLDLLVEQVQELKRQHQAAGGLQHESQGKARPEGQSPVEEVPGKAKGE
QLADVPGHGSGDPALALREERRRPPGAEPAGMVALGQLLLQLREELTAVWRDKDAARGVL
GRPAGKGVWGTSQAEAAAAAWEKMEARLEQPECPEGASLQAQAASPTSPAREGQAQEERA
QEARGEPLGAPEGAGPKGQLEKEVSALRLSNSNLLEELGQLGRERQRLQGELQALGQRLQ
REYMPRPEAQGQLQQLRSSVGLLAEELAAEKEATEQLRRRLEAQSTGLQGLRDRLPPDLS
PQGSASDPLEELQACVGALVARYDQAQRELASLERENQRLKGSCQDTGAPQAVPQVAALE
QDLGKLEEELRAVQATMGGKSQEIGKLKQLLYQATEEVAELWAREAVSLKQQEKSRASLV
AQAQSWGQELKAVLEKYNNACKETGQLRDAVAEERRRSRELAARATEQERQAREMRGRSE
QFEKAGEVLKEKMDQLIAACREKEAKIKELLKKLEQMSAEVLAVRGENTHLVLQLQDSQK
NHQEIISTYRNHLLNAARGYMEQDVYKILLRILKMQE
Download sequence
Identical sequences F7EF45
ENSMODP00000023373 13616.ENSMODP00000023373 ENSMODP00000023373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]