SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023657 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023657
Domain Number 1 Region: 440-685
Classification Level Classification E-value
Superfamily vWA-like 6e-70
Family Trunk domain of Sec23/24 0.0000896
Further Details:      
 
Domain Number 2 Region: 193-458
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.62e-37
Family beta-sandwich domain of Sec23/24 0.0035
Further Details:      
 
Domain Number 3 Region: 688-783
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-36
Family beta-sandwich domain of Sec23/24 0.0014
Further Details:      
 
Domain Number 4 Region: 890-1031
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.45e-31
Family C-terminal, gelsolin-like domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 5 Region: 784-889
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 1.7e-27
Family Helical domain of Sec23/24 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023657   Gene: ENSMODG00000018960   Transcript: ENSMODT00000024077
Sequence length 1035
Comment pep:known_by_projection chromosome:BROADO5:5:10960317:11085644:1 gene:ENSMODG00000018960 transcript:ENSMODT00000024077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVAAPPYSQTQPGIGALSPPLRGHYGDPSHPTPPAGIMKPAGPLGPTAPVGVLPP
GPPNSGAHQFVQNGPNISGYPQQRFPGPPSASDAAPPYPPYSHMPSATYPSPVSSSATTQ
LTNQLGSMQIHNYGPGMASGSQGIPAPPSAASFQGHPQLPQPAILQPGPRMPPPPPSMHN
GLGTTPSLPPASRQDALPGSGPPTANFSSLPLSGQPPGPGYPPQPGANYGPPQMPGAQLS
SPAGFPGGPAQMAGPMQPPKKLDPDSIPSPIQVIENDRSTRSGQVYTTNLRGQVPPLVTT
DCVIQDQGNASPRYIRCTTYCFPATSDMAKQSQLPLAAIIKPFATVPPNEMPLYLVNHGE
TGPVRCNRCKAYMCPFMQFIEGGRKFQCGFCNCVNDVPPFYFQHLDHIGRRLDHYEKPEL
SLGSYEYVATLDYCRNNKPPNPPAYIFMIDVSYSNVKNGLVRLICEELKMVLENLPKEEQ
EEASAIRVGFVTYNKVLHFFNVKSNLAQPQMMVVTDVAEVFVPLLDGFLVNYQESKAVIH
NLLDQIPEIFADSNENETVFAPVIQAGMEALKAADCPGKLYIFHSSLPTAEAPGKLKNRD
DRKLINTDKEKTLFQPQTNIYETLAKDCVAAGCCVNLFLFPNQYVDVASMGLVTQQTGGT
LYKYNNFQRHLDSQTFLNDLRNDVQKMTGFDAIMRVRTSTGFRATDFFGAIYMNNTTDVE
MAAMDCDKAVTVEFKHDDKLSEDSGALIQCAVLYTTISGQRRLRIHNIGLNCSSQLADLY
KSCETDALINFFAKSAFSAVLTQPLKTVRDILVHQTAHMLACYRKNCANPSAVSQLILPD
AMKVFPVYMNSLLKNCVLLSRPEISMDERAYQRQLVMAMSVADTQLFFYPQLIPIHTMDI
KSEILPAAIRCSEERLSEGGVFLLANGLRMFLWLGGSSPPELIQGIFNVPSFTHINTDVT
SLPEVGSPYSQKLRLIMSNIQQKKPYSMKLTIVKQREQPEIAFRQFLVEDKGLYGGASYV
DFLCCVHKEICQLLS
Download sequence
Identical sequences F7G0E0
ENSMODP00000023657 XP_007495615.1.35504 ENSMODP00000023657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]