SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026278 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026278
Domain Number 1 Region: 34-106
Classification Level Classification E-value
Superfamily Mitochondrial ATP synthase coupling factor 6 5.75e-30
Family Mitochondrial ATP synthase coupling factor 6 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026278   Gene: ENSMODG00000021011   Transcript: ENSMODT00000026746
Sequence length 108
Comment pep:known_by_projection chromosome:BROADO5:4:7538493:7550194:1 gene:ENSMODG00000021011 transcript:ENSMODT00000026746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNRLSRFSSLVQSATSVYSQRNITMTAIAFSKELDPVQKLFVEKIREYKSKRQTVGGP
VDTGPEYQQDLERELFKLKQMYGKGDMNTFPTFKFEDPIFEEAPKPQA
Download sequence
Identical sequences F6QZT0
XP_007493226.1.35504 XP_007493227.1.35504 ENSMODP00000026278 ENSMODP00000026278 13616.ENSMODP00000026278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]