SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000026840 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000026840
Domain Number 1 Region: 567-659
Classification Level Classification E-value
Superfamily DEATH domain 9.08e-23
Family DEATH domain, DD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000026840   Gene: ENSMODG00000021482   Transcript: ENSMODT00000027321
Sequence length 665
Comment pep:known_by_projection chromosome:BROADO5:3:264536485:264598209:-1 gene:ENSMODG00000021482 transcript:ENSMODT00000027321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSPPLFSLPEARTRFTNSTRDALINKNIKPLLSTFSQLAGSENEKKCTLDQAFRVILE
EEIKLLSIQNITRASCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIF
TFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKS
GLNLQSQFNLENVTVFNTNEQESTLGQKHIEDRDEGMEVEEGEMGDDEAPTSCSIPIDYN
LYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKLEELKTGG
EHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWI
EDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERPSDSKPTRVV
RKRTAPEDFLGKGPNKKILMGNEELTRLWNLCPDNMEACKSESREYMPTLEEFFEEAIEQ
ADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKEL
PPPSEEIKTGEDEDEEDNDALLKENNESPDVRLDKPVTGDQIELFANKLGEQWKILAPYL
EMKDSDIKQIESDSEDVKMRAKQLLVAWQDQEGIHATPENLINALNKSGLSDLAESLTND
TETSS
Download sequence
Identical sequences F7G2Z0
ENSMODP00000026840 ENSMODP00000026840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]