SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027121 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027121
Domain Number 1 Region: 291-507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-37
Family Laminin G-like module 0.000000415
Further Details:      
 
Domain Number 2 Region: 71-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-31
Family Laminin G-like module 0.00073
Further Details:      
 
Domain Number 3 Region: 13-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000028
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027121   Gene: ENSMODG00000022707   Transcript: ENSMODT00000028630
Sequence length 530
Comment pep:known_by_projection chromosome:BROADO5:Un:50142862:50154186:1 gene:ENSMODG00000022707 transcript:ENSMODT00000028630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWLRGGLFGNNPCLPNPCHHGATCQAREADMFHCQCPKGREGPTCADERNPCQPNPCQ
GAATCRVLPEGGAKCECPMGRGGQFCQTVTEQDPSRPFLPNFNGFSYLELKGLHTFGDVR
GEKMAMEVVFLAQSPRGGLFYNGQKTDGKGDFVSLALHGGHLEYRYDLGKGAAVIRSKEP
IALNKWTRVSLERNGRKGAMRVNDGDRVLGESPKSRKMPHTVLNLKEPLYVGGAPDFSKL
ARAAAVSGGFDGAIQLVSLKGRQLLTRENVRDAVEISSFPDHPCTQASGQPCLNGGSCSP
QQDTYECLCLGGFSGVHCEKGLIEKSAADLDSIAFDGRTFIEYHNAVTTSELTNEIPAPD
AMDSGVLPSEKALQENHFELSLRTEAMQGLVLWSGKGTERADYIALAIVNGRLQMTYDLG
SQPVVLHSTVPVNTNRWLRVKASRVQREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGG
LEKLTVAHSLPKAYSTGFVGCLRGVVVGQKELHLVEDALHKPTLRHCSAP
Download sequence
Identical sequences H9H8J7
ENSMODP00000027121 ENSMODP00000027121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]