SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027485 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027485
Domain Number 1 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 259-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.26e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 409-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-16
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 140-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000225
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000027485
Domain Number - Region: 109-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000299
Family Classic zinc finger, C2H2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027485   Gene: ENSMODG00000022838   Transcript: ENSMODT00000029026
Sequence length 481
Comment pep:novel chromosome:BROADO5:Un:8288068:8293931:1 gene:ENSMODG00000022838 transcript:ENSMODT00000029026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTGEEEPGWKEGPASPPRPTAMKAASKGQLHTGTFQQEKSGPASEGGPGFWAHVRVVWG
GFADSSPMSEVKEPIADNDSSQDLLQEEERKRESELKRLVRPVPARHLHPREKRECGACG
KAFLSHSNLVVAQGVPGRERTYRCHSCMMAPSQSSHLIPNQRICTRQKSYKCSECGRSFS
RHSHLIQHQRIHTGEKPYQCEECGKAFSQCSHLIKHQRIHTREKLCPCGACGKAWNNQRM
NPADMPYHCGECGKALGCHSDFLKHQKSHTGEKPHQCRECGKAFSHCSHLIVHERIHTGE
KPYKCNECEKAFTQFSNLIQHQKIHTGEKPFRCNECGKSFSRHSHLTQHQRIHTGEKPYQ
CQECGKAFSNRSHLIQHQRVHTGEKSYQCNECGKAFSHCSHLIVHERIHTGQKPYPCNEC
GIAFSQCSNLVKHQRIHTREKPYQNNECVKTISHRPYLIKHQKAFIQNTPLSQRVHTQLE
T
Download sequence
Identical sequences H9H9K5
ENSMODP00000027485 ENSMODP00000027485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]