SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028156 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028156
Domain Number 1 Region: 659-751
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000118
Family Canonical RBD 0.0017
Further Details:      
 
Domain Number 2 Region: 1971-2011
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000425
Family HkH motif-containing C2H2 finger 0.041
Further Details:      
 
Domain Number 3 Region: 897-985
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000982
Family Canonical RBD 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028156
Domain Number - Region: 426-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000395
Family Classic zinc finger, C2H2 0.059
Further Details:      
 
Domain Number - Region: 1006-1056
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00104
Family Canonical RBD 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028156   Gene: ENSMODG00000010964   Transcript: ENSMODT00000029736
Sequence length 2021
Comment pep:known_by_projection chromosome:BROADO5:1:704740792:704819365:-1 gene:ENSMODG00000010964 transcript:ENSMODT00000029736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPRFNPRGHFPGQRPQAPNPSGMKPHGGYMRTETMGIPRLQPSGRPHGIAQRFGGHES
YQSMGPHRTNVQMMQHRTDPRLAKEKMDFHEAQQKKGKPHVGQWDDSPRPSGTSGLKRGS
ATHITDQSPKVHSRYTKESASSILASFGLSNEDLEELSRYPDEQLTPENMPLILRDIRMR
KMGRWLPNLPSQRSGKETLGGETVSSNVIDYGHASKYGYTEDPLEVRIYDPEEPTEENKA
EFQSQQNISVSAPNVICNTMFPVEDLIRQMGFQSESSSNQSFFPVDSANKMSNLNMTGQS
VLEPVNSVSQSISQAMSQSLISSMSQSLIPPPMSQQSFSAELITPVSQQERISHEPVINS
SNMHIGSGGGKKNYSSEPDAPIQSPFGIVKASWLPKFSQTGAQKMKRLPTPSMMNDYYAA
SPRIFPHMCSLCNVECSHLKNWIQHQNTPAHIESCRQLRQQYPDWNPEILSSRRDEGNRK
ENQTPRRRTHSSSVSPRRSRGPSFSHKLRRSRSRSPGRYMPSRPRSRSPRYSHRFSPRHR
SRSPHRSRNPLRGSPKPPRSASSEWTSRRRPRSPDKRSSLEAVVQSLGHGFPAEFSKQKH
FEASGKGRSSTQKSLSSSSKLPCKTVGSTKSESSASHTARHKAKNPEDASSSQVLEESVT
QRKPWEDESLRCDTIIHVSELPTDGYTEQDIIKIVQPFGKVSDLLIVPSRNEAYLEMKFK
EAVAAAVKYCETTPVQVKGKRVKISTAGKKKLPSANQVNGSKHNIGFMDLSTFSIRKDGD
GSKTESVMAASTGNLTKTGHVKATAAVVTKPAGKSSVNKKSVISASAKSNKTSNKSAKPS
GKKTIENKKPIDSQIKDSNKAVTVPEHTETRNISETKSIPEATENTAKENASAVSGITEN
EDSVNKETEEMCIVLISNLPNKGYSTEEVSNLAKPFGGLKDILILSSHKKAYMEINRKSA
DSMVKFYTCFPMSMDGNQLSINMASENVNLKDEEAIFTTLIKESSPEANLDTIHKQFVHL
GNLPDDGYTEQEVVCVGLQFGKVDRYVFINNRNKVIFVHLNLFFSSSFLLLKKEIYQHTE
GFGKERLKESFSHHYDSEDAGISMTVFKFYAEGDTFNPDLKNNPVDESEVQTAADSSSVK
PSEIKEEAIPNPVLQMEPSTLQEEPSKGEPERGAVCDSDLAPGKVEVEVQVEEAELRNTD
GNSAPTMVKDNSENSMITLQENMADLEKEEKVKVKPELELALCAGPCAEEDSKQKMEESL
PETEDVHDVEKSGNALLGFVGEATTDMEVLEASAEVLLPVSPMVTIQGASTGNEKAAVSK
EEICDKNTMEEKEDKGTDFKDTRIELKTALEIGPEKEPEKNGAEDALGMEKSERIVVTRE
KTGDSTVTKEHVNKGVGQPSKPDETSKTSVQVVSNASSSKLSSKLMASTPNTLKTKVTGQ
KSEVKTEDQRTCSKLLPKSQASVEKKLTTKDMGSLRPASARSTLGESGSKSKTSPSGIAR
GSSGRTSVPQDKDYRALAKQSQETETRPSTMKRDDSGNKTSAGQNTKNPKGSSGKTAKPR
EEEELFPFNLDEFVTVDEVIEEVDPSQAKQNAPKGKKKEPLKNLPSSEINLKRRKGKSSV
SCVAESELSFVTLDEIGEEEDAAAHLTIESSLETKALVTVDEVNDEEELNVEEMVQNANS
LLTLDEIIEQEDCTSHSEPKDVTILSVDEERDLLKREPLVTVDEIGEVEELPLTESADIN
FAPINPKEEENVVRESIGFISSQVPEDPTTLVTVDEIQDDSSDVHLVTLDEVTEEDEESL
ADFNNLKEELNFVTVDEVGEEEEGENELKVETARKDVCSVAKTGGIKKKPITVKQEKPRA
LQQVGQINEEIIEKDPKTMTERHLAAKTPAKRSRTKKVPSSETFDTSEPPKLEETSMTIG
KIGLFESEDAEPEKKRKKDEESSLGNLIHTHPLSSLSFCLVDLDFLIPKAGFFCPICSLF
YSDQKTMANHCKSARHKQNTEKFMARQKEKERKEAEEKSSR
Download sequence
Identical sequences F7G1W1
ENSMODP00000028156 13616.ENSMODP00000028156 ENSMODP00000028156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]