SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028376 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028376
Domain Number 1 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 192-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 248-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 5-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.01e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 7 Region: 157-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-17
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 8 Region: 295-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000364
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028376   Gene: ENSMODG00000023101   Transcript: ENSMODT00000029958
Sequence length 488
Comment pep:novel chromosome:BROADO5:2:538590131:538598526:1 gene:ENSMODG00000023101 transcript:ENSMODT00000029958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLKVLTFQDVAVDFTREEWRLLSPAQKELYREVMLENAWNLLSVGLPAPPEDVLSCLEQ
REGPWMLEQEGLRSFSPGVSYRCQRDMFYCLFLLEGEIRREMKATPTEMSPSVEETDQQR
PMTDIPNNVAWREFCVESQNSSHAEHQKLNSEEKSSEWKQCGKTFRQRHKLTIHQRIHTG
KKPYECNHCGKTFNHRSSLVVHQRIHTGEKPYECKQCGKTFRERQKLAIHQRIHTGEKPY
ECKQCGKAFNHRSSLVVHQRIHTGEEPYECKLCGKTFRQRHKLAIHQRTHTGEEPYECKL
CGKTFRQKNKLAIHQRIHTGEKSYECKQCGKTFNHRSSLAVHQRIHTGEKPYECKQCGKT
FSHNSSLARHQRIHTGEKPYECKQCGKTFYHNSSLPQHQRIHTGEKPYECKQCGKTFNHN
SSLAQHQRIHTGEKPYECKQCGKTFNHRSSLAVHQRIHTGEKPYECKRCGKTFSQRSHLV
KHLRIHTG
Download sequence
Identical sequences F7EWZ9
ENSMODP00000028376 13616.ENSMODP00000028376 ENSMODP00000028376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]