SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028687 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028687
Domain Number 1 Region: 790-873
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000497
Family Myosin rod fragments 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000028687
Domain Number - Region: 678-722
Classification Level Classification E-value
Superfamily EF-hand 0.000114
Family Calmodulin-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028687   Gene: ENSMODG00000009328   Transcript: ENSMODT00000030270
Sequence length 884
Comment pep:known_by_projection chromosome:BROADO5:1:584689223:584703003:1 gene:ENSMODG00000009328 transcript:ENSMODT00000030270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKQRVFTGIVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVK
VQTLSNQVLSPCQNFLIFTPQPLLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPL
FPQKRDLFQTSPTLHLSHLSRFPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRH
ELPPYRVHLTPYTVDSPSCDFLELQRRYRSLLVPSDFLVVHLSWLSAFPLSQPFSLHHPS
RIQVSSEKEQGPSANSESTPPDSDMTYSAKVLLLSSPGLEELYRCCLLFVEDMAEPRESP
EHPLKQIKFLLRRKEDEAVMVGGEWSPSLDGPDPKADPQVLVRTAIRCARAQTGIDLSNC
TKWWRIAEFRYIQLGPPRRQRTVVVYLPDIWTLMPSLEEWEALCQQKVAETVAPLQDTVM
VSLTLGERESKVFGLTAEASVEETNSSELGAAAEASEQDPENPELSLQQEMDPSLPEAPP
PPLEPVIIAQPGCTNFSLHALLEDRRPREKISFEVMVLAALFQEMLQRDFGYKIYKMLLS
LPEKEVPPPEPEKEEVVKDEVAKEEVAKESKDEAQNEGTSTEPDNLRKGRVKKKKRIDCL
LRKQKNKNTNRCKKMSPTQGQKSKDGLLPKPSASGEEEEEKARGEASEDLCELSLDAELL
LLREEPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERVLLTLGLQLTAEQAKKLVS
RVVSQNICQYRSLQYSRQDGLDGGLPEEALFGNLDLLPPSSGENTKPIAPHAEHRGLVSH
NGSLIHVGNLLQRAEQQDSGRLYLENKIHTLELKLEETHSRFSTTEATNKTLSADMQELR
TRLAEAEEMARTAERQKNQLQRLLQEFRRRLTPLQQEMQRMAEK
Download sequence
Identical sequences F7FZS2
ENSMODP00000028687 13616.ENSMODP00000028687 ENSMODP00000028687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]