SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029936 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029936
Domain Number 1 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 254-311
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.99e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 170-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.94e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 535-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 590-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 8 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 9 Region: 686-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 10 Region: 2-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-18
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 11 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-17
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 12 Region: 632-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000582
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 13 Region: 217-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000109
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 14 Region: 733-765
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000231
Family Classic zinc finger, C2H2 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029936   Gene: ENSMODG00000023456   Transcript: ENSMODT00000031506
Sequence length 766
Comment pep:novel chromosome:BROADO5:4:410208061:410220847:-1 gene:ENSMODG00000023456 transcript:ENSMODT00000031506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSITFKDVAVDFTQEEWCLLDPSQKELYREVMLENVQNLLFVAGSRTEAKAGTTLRISKQ
TYARMLESQNEQGASSYKSKIYLWFSVRGITMAVREKKAQRSPVQGKEIHCEVSLLLYGK
FGSYEIIHSGERHYQCKEYGKGFTQRVHLVRHQRIHTGEKSYECSQCGKTFKHRVNLTIH
QRIHTGEKPYKCTQCGKAFTQRGHLAKHQRIHTGEKPYECTHCGKTFKLRSNLAKHQRIH
TGEKLYECTQCGNAFTKRSTLAAHQRIHTGEKPYECTYCGKAFTQRSTLAAHQRIHTGQK
PYKCTQCGKAFTQRITLVTHQRIHTVKKPYECTQCGKAFTESGSLAAHQRNHIGKKPYEC
TQCGKAFTESSSLARHQKIHSGEKPYECTQCGKAFTRRDHLCKHQKIHSGEKPYECRQCG
KAFKQRSHLAKHQGIHTGEKPYECTQCGKAFKQRSNLAKHQRIHTGERPYECTQCGKAFK
QRGNLVAHQRIHTGEKPYECTQCGKAFTRRDHLVIHKRIHTGEKPYECTQCGKPFTHSIS
LAAHQRIHSGEKPYECTQCGKAFKHRVSLTIHQRIHTGEKPYECTQCGKAFKQRGNLVAH
QRIHTGEKPYECTQCGKAFSRRDHLVIHKRIHTGEKPYECNQIGEPGKAFTESSFLAKHQ
RINTGEKPYEYTQCGKGFSQRGNLAAFIRRNHLTTHQIIHPGQKPYECTQCGKPFTHSIS
LAAHQRNHSGKKPYECTQCGKAFTRRGHPVIHQRIHTGKKPYGCNQ
Download sequence
Identical sequences F6TNR3
ENSMODP00000029936 ENSMODP00000029936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]