SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030503 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030503
Domain Number 1 Region: 280-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-27
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 449-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 393-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-22
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 6 Region: 32-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 7 Region: 226-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030503   Gene: ENSMODG00000011141   Transcript: ENSMODT00000032074
Sequence length 549
Comment pep:known_by_projection chromosome:BROADO5:1:423445557:423462435:1 gene:ENSMODG00000011141 transcript:ENSMODT00000032074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEGGLYSQDSVLSEEGRLEDEGMAGVLLTAKSQESVAFKDVVMDFTPEEWKQLELPQK
DLYKDLMLEKYRNLVLLGLPVSKPDVNSELEQGEGEESWIPRKEVPGSTCSDWETVPKSK
KSPPNLDFFEDDSPASEKAIMETLPRISPENPTFQDTWECDGRLERQQENQERDLRQVKI
THKKPSPGERGHEISELGRNFGLRSVLVTQQRIPIGKGLFKYNTHRKNSELLKHRKIHAG
EKPYTCNDCGKGFSYCSSLSQHQKSHTGEKPYECNECGKAFSQSSSLVQHQRIHTGEKPY
KCNECGKAFSQNANLTKHQRTHTGEKPYKCNECERAFSDCSALIQHQRIHTGEKPYECNE
CGKAFRHSANLTNHQRTHTGEKPYKCIQCGKSFGYCAAFIQHQRIHTGEKPYKCNECGKA
FSQSANLTNHQRIHTGEKPYKCNECGKDFSQSTNLIIHQKIHTGEKPYECNECGKAFSDS
SALIRHHVIHTGEKPYECNECGKAFNQSSSLTQHQRTHTGEKPYKCKECGKAFRCSSAFI
RHQRLHIGE
Download sequence
Identical sequences F7DC02
ENSMODP00000030503 ENSMODP00000030503 XP_007474735.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]