SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000031602 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000031602
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-22
Family I set domains 0.0052
Further Details:      
 
Domain Number 2 Region: 162-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000738
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000031602   Gene: ENSMODG00000011737   Transcript: ENSMODT00000033176
Sequence length 637
Comment pep:known_by_projection chromosome:BROADO5:1:331334477:331405022:-1 gene:ENSMODG00000011737 transcript:ENSMODT00000033176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETKRKGRGRGKKHREGRKRERERAPELGDEAVPPKLKKMKSQTAQVGEKQSLKCEAAA
GYPQPTYRWYKDGKELNRSKDIRIKYGNGKNSRLQFNKVKLEDAGEYVCEAENILGKDTA
KGRLNVNSGMSLGESGSYSNNMSFYMSLLFPVATTLSSWSGHARKCNETAKSYCVNGGVC
YYIEGINQLSCKCPVGYTGARCQQFAMVNFSKHLGFELKEAEELYQKRVLTITGICVALL
VVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEELQMADYISKN
VPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHSHTWSLEQTESLTSDSQSGIMMS
SVGTSKCNSPACIEARARREAACNIEDERRPAMPYHDSVDSLRDSPHSERYVSALTTPAR
LSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISFRLAEQQPLLRHSPATAAAASAA
PASDMQRSYDSYYPPRRGCSHDSMGSLPASPFRITEDDEYETTQECAPTLEPPKRTATGH
RRWRKSRLNGHMAQRARAVRDSFSLSSASYSESDEELVAECTPFLSIHTSDMLGTDSPPL
YQPVDSRTYYSLDRHSTQESRHSRITHPRGKQDSAPL
Download sequence
Identical sequences F6X5V9
ENSMODP00000031602 ENSMODP00000031602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]