SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034640 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034640
Domain Number 1 Region: 60-114
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.55e-17
Family KRAB domain (Kruppel-associated box) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034640   Gene: ENSMODG00000028331   Transcript: ENSMODT00000036228
Sequence length 273
Comment pep:novel chromosome:BROADO5:6:147576677:147607226:-1 gene:ENSMODG00000028331 transcript:ENSMODT00000036228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPGKFLVPWAKERIPQGRKLEVRDLSKIMKNSRLLLPHLCSASKSSQEHHSKRDRMM
PVTLEDVAVYLSREEWRQLDPAQRNLYRDVMQEKNGLTLGFPFSKDSLAPHLERKGESSS
SCHQGTEGTSKRKGIYSEAAKIGKTGFIPPLEAVGDAKMLATGLGKDYGDVPKSMEQEDT
RENPRESQQLSLLEKSQKNLVLHDKDLEKPLDILQNPCIPEKCYQDSSGEGPDPGRDRVG
PELELVAPQLTLSPKKLTHVKSVGRISAGILTL
Download sequence
Identical sequences F7BTV5
ENSMODP00000034640 ENSMODP00000034640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]