SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034659 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034659
Domain Number 1 Region: 1038-1219
Classification Level Classification E-value
Superfamily Fibronectin type III 1.82e-20
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 812-938
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000108
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 3 Region: 730-799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000179
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 4 Region: 941-1020
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000754
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 5 Region: 1341-1381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000037
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 381-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000452
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 7 Region: 306-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 8 Region: 577-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 9 Region: 465-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000336
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 692-730
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000107
Family EGF-type module 0.03
Further Details:      
 
Domain Number 11 Region: 346-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000175
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 266-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000084
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 13 Region: 466-572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000534
Family Growth factor receptor domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000034659
Domain Number - Region: 420-458
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000155
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034659   Gene: ENSMODG00000015995   Transcript: ENSMODT00000036248
Sequence length 1448
Comment pep:known_by_projection chromosome:BROADO5:7:251512082:251591357:1 gene:ENSMODG00000015995 transcript:ENSMODT00000036248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLARWTLLLTLASWGHAIVPLADFYPFGSEVGDAVTPKQDDGGSGLLPINVQFPFFGA
GHTGLYVNNNGIISFLKEVSQFTPVAFPISKDRCVVAAFWADVDNRRAGEVYYRESKEPA
ILQRATEDICRHFPEFPDFSATWAFVATWHQVTFFGGSSFSPVNTFQIVLITDGKLSFTI
FNYESISWTTGMHASSGGDLAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIVNVEMTTNV
GIPGRWVFRIDDAQVQVGGCSNTTSVCLNLRPCLNGGKCIDDCITGNPSYTCSCLAGFTG
KKCHVDVNECASEPCQNGGTCTHGINSFACQCAPGFKGPTCGAAESPCDAKDCQNGGECQ
AANGTAVCVCQSGYTGDNCETDINECDSDPCLNGGKCVDLVANYSCLCSEPFAGPRCELD
PSACEDRSCRDRQTCNYIRPGRYICTCSPGYYGNNCQYGGPRTPSACLSNPCQNEGTCLE
TDQGYICECPDGFTGFNCAEKLPEDCECRNGGRCLDGNFTICHCPPGYFGLLCEFEVTAT
PCNVNTQCPDGGYCMEYGGSYLCVCHTDYSTNHSLPSPCDSDPCLNGGSCDAHDDSYTCE
CLRGFHGKHCEKVRPRLCSSGPCRNGGTCKESDGAYQCSCPYRFTGRHCEIGKPDSCVSG
PCQNGGTCFHYIGKYKCDCPPGYSGRHCEIAPSPCFMSPCENGATCSDLGTDYACRCRAG
YTGKRCQSEVDCGTPSSVKNTKVRLNSTKMGSLAEYECERGYVLSSGNKARVCRAHGLWS
EPPQCDEINECASQPCLNGGSCKDRIASFLCVCGPGYAGPRCEVEIDECQSDPCKNGGTC
KDLPAAFVCQCPDGFAGIHCEKEVDACDSDPCQHGGECENDGGSYLCVCPEGFFGYHCET
ASDPCFSNPCGGRGYCLSSNGSHSCTCKVGFTGRNCAKELLPPTALKVERVEDSGVSISW
RPPEDQAAQHMIDGYAVTYASFDGSYRRTDFVDRSHSAHQLRALASGRAYNISVFSVKRN
VNNKNDISRPAVLVTRTRPRPVEGFEITNVTASSIAVQWALHKAKHSTVNKVRVSIRRLG
EPEDLSVELDSTTDKYTFWELRPGEKYIIHVATLSGLGTEDHPSESLATAPFHVWTRPPS
PRNLTASRVTATSAHLTWEQLPAGASVEGYIINVTTSQSVKSRYVPSGKLTAYTMRDLQP
GQRYRLSVTAVQSTEQGQMHSEPAHLYVLTPQRDGSSDRRWNQGGHPRVLRNRLPPAFLP
DLRLLADREVSEEPSQAPRFTELVDGRGRISAQFSSVPSPAVTVRSQPEAPVKLENLEES
TNRISLALQLPEPASKQEEDDHRNCSVNPCQNGGTCVSGTDSYSCDCSPGFKGRHCELSC
KKVPHSCTRLYSETKSFPIWEGGVCHYVYKRIYKVHPDICYKESCEGTTTTKKTPNRKQG
NSQTMKKP
Download sequence
Identical sequences F7B7B4
XP_007502470.1.35504 ENSMODP00000034659 ENSMODP00000034659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]