SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034900 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034900
Domain Number 1 Region: 124-258
Classification Level Classification E-value
Superfamily Acid proteases 2.88e-39
Family Retroviral protease (retropepsin) 0.00006
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily dUTPase-like 6.67e-25
Family dUTPase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034900   Gene: ENSMODG00000024620   Transcript: ENSMODT00000036488
Sequence length 274
Comment pep:novel chromosome:BROADO5:1:148496855:148497676:-1 gene:ENSMODG00000024620 transcript:ENSMODT00000036488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARATTGSAGLDLCSSSTRILTPEDGPEVISTGVTGPPPPGMFFLIIGRALTTLQGVVVH
PTLVDNDYTGEIKLIVESPHGPVTIPAGHRLAQALPLPMVGDFPTIEQTRGPSSPGSSNI
YWAQQITESRPTLQLSLDGKKFIGLLDTGADSTVISHKHWPCAWPLQPSTTHLSGIGQVN
HTLQSSKFLTWRDAEGNTGTTRPYIVKGLPVNLWGRDILAQMRLLMVSPSDPVTQMMLKS
GFLPGKGLGKNEQGDPQPISLTPNRDKAGFGSQN
Download sequence
Identical sequences F6QUP7
13616.ENSMODP00000034900 ENSMODP00000034900 ENSMODP00000034900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]