SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035688 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035688
Domain Number 1 Region: 261-439,466-497
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-20
Family Clostridium neurotoxins, the second last domain 0.062
Further Details:      
 
Domain Number 2 Region: 79-187
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000457
Family Cadherin 0.0031
Further Details:      
 
Domain Number 3 Region: 29-91
Classification Level Classification E-value
Superfamily Cadherin-like 0.000006
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035688   Gene: ENSMODG00000018182   Transcript: ENSMODT00000037274
Sequence length 904
Comment pep:known_by_projection chromosome:BROADO5:8:108694549:108720938:1 gene:ENSMODG00000018182 transcript:ENSMODT00000037274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XDAPLRYAGEICGFRLHGAGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHSFTIQAYDC
GEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLYRASVTEGKLYDRILRVEAIDGDCS
PQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRAADDAEV
EIQVKPTCKPSWQGWSKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKG
CDRDNYSERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQV
PLGSGGGIGSGSQDGLSDHFTLSFWMKHGVTPSKGKKEEETIVCNTVQNEDGFSHYWLTV
HGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYVDGISFDPALIH
DNGLIHPPRQEPALMIGACWTEEKNKEKEKGGGDNSTDVNPGDPLPIHHYFHGYLAGFSV
RSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQH
VAYMNTLRFATPGVRPLRLATAVNCFFQESCVSIPDVEGYFVVLQPDAPQILLSGMTHLA
HPAVDFEGPEGVPLFPELQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISL
VGDDLDPERESLLLDAASLQQRGLEISNTSAYITISGVESITVYEEVLRQARYKLRHGAA
LYARKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRAAYPSHVLSSQQFLHHGHQLPAEMAG
HSIASAHPNSMVPSAATLIIVVCVGFLALMVVLGLVRIHSLHQRVSGVGGSPGASDEPKD
PDLFWDDSALTIIVNPMESYQSRQACVAGAAGGQQEDEDSSDSEAADSPSHEERRIIESA
PHRY
Download sequence
Identical sequences F7FAT6
ENSMODP00000035688 ENSMODP00000035688 13616.ENSMODP00000035688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]