SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000035721 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000035721
Domain Number 1 Region: 1922-2222
Classification Level Classification E-value
Superfamily BEACH domain 1.29e-124
Family BEACH domain 0.00000000941
Further Details:      
 
Domain Number 2 Region: 2343-2616
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-28
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 1825-1921
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-26
Family PreBEACH PH-like domain 0.0053
Further Details:      
 
Domain Number 4 Region: 521-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000148
Family Laminin G-like module 0.057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000035721
Domain Number - Region: 110-303,398-514
Classification Level Classification E-value
Superfamily ARM repeat 0.00127
Family Armadillo repeat 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000035721   Gene: ENSMODG00000016268   Transcript: ENSMODT00000037307
Sequence length 2632
Comment pep:known_by_projection chromosome:BROADO5:7:193165553:193335588:-1 gene:ENSMODG00000016268 transcript:ENSMODT00000037307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGLEDQQQALSILLVKFFIILCRNLSNVEEIGTCSYINHVITMTTLYIQQLKSKTKEK
DVADQSSIEEFVRHALAFCESLYDPYRNWRHRIAGKSLSTVEKSRQKYKPASLTVEFIPF
FYQCFQESEHLKESLKCCLLHLFGAIVTGGQRNALQAISPATMEVLLRVLADCDSWDDRD
PEEVNRKAELTLKCLTEVVHILLISSSDQRQVDTSTILENYFKLLNSDHSAFPPQRRSRQ
WESRFIALQIQMLNTITAMLDCTDRPVLQAIFLNSNCFEHLIRLLQNCKLFLNANSKVAD
KNEKDLANKLLTEMNEDQVFQEQLDCLAISTIQALTAVMNKSPAAKEVFKERIGYTHMYE
VLKSLGQPSLELLKELMNMAVEGDHTSVGILGISNVQPLLLLIQWLAELESHDLQIFISD
WMKRICSLNRQTRTTCVNANMGLRIIDTLSSHSSLHCTCAENLIALLGSLGSQSMSSEEL
HRLLRLLRTDASKKIHSYTIPVLRGILAMARKQSLESALQYFNLSHSMAGISVPSIQKWP
GSAFSFSAWLCLDQDQLNTGISNKGGKRKQLYSFFTASGMGFEAFLTSSGVLVVAVCTKR
EYATVMLPDHNFCDSLWHNITIVHMPGKRPFGQSLVYIYVNGQQKVSALLRFPAMNEPFT
FCCIGSAGQRTTTPPPSQIPDPPFSSPITPHRTSFGGILSSASWGGNAEKSELLTKLISA
GTQDSEWGCPTSLEGQLGSVIIFHEALHPPQVKLLYLAGPNCLNPWKSPEFEMPDLPSKI
LLHYTPKACRNPICLDLSINCFHGRLTGNKVVNWDIKDIINCIGGLNVLFPLLEQISFFD
GQTTEKNRENVLPEMMTPVEGDWVVLSSTKASESRIEKNLIAMFVLVVKHFIQRHPINQE
NFIHSHGVAILGALLQKVPSNLMDVNVLVAVQLLIEQVSIEKNVQLLQQMYKFLLFDFRI
WNRGDFPFRIGHIQYISTIIKDSRRAFRKKYGVQFLLDTLRIHYGSGCKESSELSPEDVQ
TIRTSLYGLIKYFLSKGATQEEIQSIMGYIAVINEEEQLFGILDVLFSLLHTSPARDQLF
LLLFEPGNADILYVLLLNQKYSDRLRELIFKITEQMLKCTKVYERSKQRIRLRDVGYSGL
GLLLTEVPVNVSLIKNLFNQVLNTDTVVNFKDLLAVMYMSHKVDTHVRVPMCRKVLQILQ
TQPDAAQHISQQVGWQETLVRLFLKLNFVTGNELKHNRADIMKEENKKNAPEDLKKLCDE
KGEGEKLNSFYLAAATFDPWCLEERQSLDSNDISVSENQELWLNDSSHLSLDLTGIDSLE
LSDSGSQMPDSLPSTPSPIECSSKAFSVQLDKESSLTNDMGFIDDLSLLDSQERCEEELL
QLMTSILSCVMWRGLERTDDAAWIERGQVLSALTKPGISSELLRSPEEIKLCLLQKMLEW
AVTENREAKTNPATAENAFRLLLIIQDFLQTEGLVNSNLWTEKLLEDMMPLFDSLSIWYS
DSPEWLKLSQIQVHLLLGFIGTDNLQVCAMASAKLNTLLQTKVIENQAEACYLLGKLEPI
LSQSIKEQTETYSFLIPLFRTLVSKIYELLFMNLHLPSLPTANGSPSFFEDFQEYCNSNE
WKIYIEKYIMPYMKQYEVQTFGDDCESMALYWKDCYEALMVNMHKRDREGGESKLKFQDF
FVEPFKRKARQENLRYNGMLKQLSSQHLATLRQWKSIQLYLTCERGPWAERKQNIIHWKL
ANVENYSRMKLKLVQNYNFNSHEEASALRDNLGVQHSQLSNESLLLEAVKQVKVNDREED
KLDLPEEDTTTRADVDEKGEQSQKEKLVLSEDCELITVIDVIPGRFEVTTQHIYFHDGSI
EKEDGIGYDFKWPHPQIREIHLRRYNLRRSALEIFLIDQSNYFLNFKKEVRNKVYSRLIS
FHSPNVHGTRSPQELFKASGLTQKWINREISNFDYLIQLNTMAGRTYNDLAQYPVFPWIL
RDYTSEDLDLNNPAVFRDLSKPVGAVNDKNAKAVQGKYENFEDPLGIIDKFHYGTHYSNP
AGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFYSIPATWQALMDNPYDVKELIPEFFYFP
EFLENQNHFNLGRLQISKELVNDVVLPKWAKSAEDFIYKHRKALESEYVSAHLHEWIDLI
FGYKQRGPDAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQTPCQLLKEPHP
PRLSTEEAVQRQIKTDTATLNLFHHLPELHSFFVEGISDGVPLVKAIVPRNQPRSFMTQG
SPEILLTASMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKTQRGINGPFAPGLDITSK
LFVVSHDAKLLFSAGHWDNSIRVTSLTKGKMIAQHIRHMDIVTCLSTDYCGIHLISGSRD
TTCMIWQVAQQGGIPVGLVPKPLQILYGHTDEVSCVGISTELDLAVSGARDGTVIIHTVQ
KGQYMKTLRPPCESSLLLTIPNLALSWEGHIIVHSSIEENTTLKDKNALHLFSVNGKYLG
SETLTEQVSDMCVAGEHIIMGSLQGFLSIRDLHSLNLSISPLSMRLPIYCVSVTKEHSHI
LVGLEDGKLIIVGVGKPAEMRSGQLSRKLWGSSKRLSQISAGETEYNTQHSK
Download sequence
Identical sequences F7BL78
ENSMODP00000035721 ENSMODP00000035721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]