SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036281 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000036281
Domain Number - Region: 357-409
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036281   Gene: ENSMODG00000024931   Transcript: ENSMODT00000037871
Sequence length 409
Comment pep:novel chromosome:BROADO5:8:90817037:90898764:-1 gene:ENSMODG00000024931 transcript:ENSMODT00000037871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARQCFLETPTGPLSHSHHREDVNQLLSDDQAWEKFVAEWAFMSLEDPDKITDDPDKITG
DPDKITGDINENMAHKEMEQELDMLLTNADDLKKDNDDISSYGEAFDNLEDLEDPDKITD
DPDKVTDDPDKITDDPDENMDNFDENMAFEKMEHELDMFLCKYPRLKLELEKYIQNLYST
ADNIDEIHKDCTITNVVAGSTGVVSGILTIMGIALAPVTAGGSLALSITGIGLGAAATVT
GVSAGIIDHVNDLKGRKLLSEVEGNTNANVAEKVLFKEASKLFSTLNKHSQIFKDFDNHW
KAFQVTKTNPHLMEASHRLMTGAQISSKNRRQINKAFRGTTLALTKQGRIQSATLAGASI
LVDVTNIVKDSMHLSNGAKTTTAMKLREYAQALEKKLEELSNHFEKLQK
Download sequence
Identical sequences F6RAU7
13616.ENSMODP00000036281 ENSMODP00000036281 ENSMODP00000036281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]