SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036568 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036568
Domain Number 1 Region: 287-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-43
Family SPRY domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 9-75
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-17
Family RING finger domain, C3HC4 0.0096
Further Details:      
 
Domain Number 3 Region: 93-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000153
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036568   Gene: ENSMODG00000025013   Transcript: ENSMODT00000038159
Sequence length 462
Comment pep:novel chromosome:BROADO5:5:101293523:101298776:1 gene:ENSMODG00000025013 transcript:ENSMODT00000038159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAKDLIKSLKAELTCSICLGYFTDPVTALKCGHTFCKDCLFQCDEQADATLTCPECRAV
IRYSDVVLNENLQNLSITGKTLRQHLLLSPALLTTCDQHGEKEKLFCEQDQKLICDSCLL
TQEHKDHQDLPLQMAADKCKKKLQETLNVLQEKEEELKAEISKIGKEVEYFKKDTDFYKE
VIKCEYRKMHEILYIEENRHLQKLDQEREDKLAKVEANKAKLSQQIQHVQQKILEIEESL
DEAPLEMLQQGWGVVICSTELLKCSVFPYLPQTVNLTYTIYPMTGLIEILRSYQTGITVD
PEIDTLHLIVPEHYKSLKYRLDPRNQPDKEERLDYFVTVLGTETFTSGKHYWEVDVEGQT
EWVLGICEDSVSKNENVSILSEDVKAIIGSKVKNQGFFWSSEGCFSSIPPCKMGVFLDYD
EGNITFYDVHENIVLIGFLHLAFRGPVRPFFSTSFVNKGSSS
Download sequence
Identical sequences F6TBX7
ENSMODP00000036568 ENSMODP00000036568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]