SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037671 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037671
Domain Number 1 Region: 120-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000402
Family Cripto EGF-like domain-like 0.0048
Further Details:      
 
Domain Number 2 Region: 86-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037671   Gene: ENSMODG00000025319   Transcript: ENSMODT00000039273
Sequence length 203
Comment pep:novel chromosome:BROADO5:6:19937704:19949224:-1 gene:ENSMODG00000025319 transcript:ENSMODT00000039273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIYHVRRLFLITLVFQVIHLGNGFNEKEKLKGSAEEPINTTAPKQQPPNQNPTWNSTR
DLNRSSESPKQFQSRPFIPFIGFKDGTKLCCQNGGTCVLGSFCVCPMHFVGRHCEHDERK
SNCGVFAHGDWVYKGCYLCRCIYGKLHCFRDPTLNNCDLNEEFVTLQSNGSRLQYTLYFL
LPFSCFLLQWIVLQKSSSLVPWR
Download sequence
Identical sequences F7E7D9
ENSMODP00000037671 ENSMODP00000037671 XP_007498006.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]